Selenof (NM_133297) Rat Tagged ORF Clone

CAT#: RR213906

  • TrueORF®

41532 (Myc-DDK-tagged ORF) - Rat selenoprotein (Sep15), (10 ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)



  "NM_133297" in other vectors (1)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal Anti-sep15 Antibody
    • 100 ul

CNY 5,250.00

Specifications

Product Data
Type Rat Untagged ORF Clone
Synonyms Sep15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR213906 representing NM_133297
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCAGGGCAGGGCGGGTGGCTCCGGCCCGCGCTGGGGCTTCGCTTACTGCTGGCGACTGCGTTTC
AAGCGGTGTCTGCTCTTGGGGCAGAGTTCTCGTCAGAGGCATGCCGGGAGTTGGGCTTCTCCAGCAACTT
GCTCTGCAGCTCCTGCGATCTCCTTGGACAGTTTAACCTGCTTCCACTGGATCCTGTCTGCAGAGGCTGC
TGTCAGGAAGAAGCGCAGTTTGAAACCAAAAAGCTGTATGCAGGAGCCATCCTTGAAGTCTGTGGATGAA
AATTGGGGAGGTTCCCTCAAGTCCAAGCTTTTGTCAGAAGCGATAAACCCAAACTGTTCAGAGGTCTACA
GATCAAGTATGTTCGAGGCTCAGACCCTGTACTAAAGCTTTTGGACGACAACGGGAACATTGCTGAAGAG
CTCAGCATCCTCAAGTGGAACACAGACAGTGTGGAAGAGTTCCTGAGCGAGAAGCTGGAACGCATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR213906 representing NM_133297
Red=Cloning site Green=Tags(s)

MAAGQGGWLRPALGLRLLLATAFQAVSALGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLPLDPVCRGC
CQEEAQFETKKLYAGAILEVCG*KLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEE
LSILKWNTDSVEEFLSEKLERI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_133297
ORF Size 486 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
OTI Annotation This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_133297.2, NP_579831.2
RefSeq Size 1537 bp
RefSeq ORF 489 bp
Locus ID 113922
UniProt ID Q923V8
MW 17.8 kDa
Gene Summary The protein encoded by this gene belongs to the SEP15/selenoprotein M family. The exact function of this protein is not known; however, it has been found to associate with UDP-glucose:glycoprotein glucosyltransferase (UGTR), an endoplasmic reticulum(ER)-resident protein, which is involved in the quality control of protein folding. The association with UGTR retains this protein in the ER, where it may play a role in protein folding. Knockout studies in mice also suggest a role for this gene in cataract formation and colon carcinogenesis. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. [provided by RefSeq, Nov 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...