ORF071L (NC_003494) Virus Tagged ORF Clone
CAT#: VC102361
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for ORF071L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612293
View other clones from "Virus" (121)
Need custom modification / cloning service?
Get a free quote
CNY 6,460.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102361 represents NCBI reference of NP_612293 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACAGAGCACTCCGGGACATACAAACCGACCAATTTGTACCGCATTCCTGGATGGAGCGGCATCGAC TGGAATTGCTCAGCGCTATCGTGGTTAGTCCATATGGTCCTACCCAGCTCCAGGACTGGTGTGTGGCTTT CAATACAACCGCACGCGAAGCCCTGGCCGATGTGACCGTTCCACTGGATGCTTCCGACTCAATGGTGGTC CAGGCTGTGCGCATGGGAGCCCACGTTGTGGACCTTTTTGACATGATTGACCGAAGACCCGCTGCGTTTG ACACATGTGTCCGCGAGGACAGTATCGATAGTGCAACATTCGCCACAACCGTAGGTCGGGATGGATACTC TGTGGTGCATCATCTCGCAAGACGCAACATGTTGGCGACTCTGGAAGCGCTCAAGCCATTCGACTGGTAC TCTCTGAGTCCGGACGACCACACCCTCATCGACTGCGCATTGCTTGGGGAGGGAGGGCGGCCTTCCACCG TTGTGCCATTTTTTATGAGCCGGGGCATGAGTATGAATGTTGTCGTACCCTCACTGGGAATCACATTGCT GGAACAATCCGTCCGAACCTGGCCTGGTGAGGCACTGGCGTACCTTGCCAGGACCCAGTATGTGGACCAC ATGCCTGTCGACGTGTTTGCTCATATGGTGGCCCGGAAGAACATTCCCGAGGCTGTCCTGGCCTGGGTAG GGCGGTTCGATATCCTGCATGATATGTATAAGGATACCCTTCTGATGCATCATATTGCAATCCACTGGCA GCCCGTTTATAGTCAAGTCTTCGATGCAATTGACATTGACGTTCTGAATACAGCGACTGGCCCTAAAAGA TTCTACCTGATCCACTGCGTAGGTCAGGGTATGGTCCCAGTGGCCGCTTTCAAAAGGTATGTACCTATTC AATATTGGAACATGGTCGACGCACATGGAAACACCGCAGTTGCTACTCTGTTGAACCTCCCTTTGACCGA CTATAATAAGAACATGTATAACATACAGAAGCTGACGAACATGGTGGATGCGATAGAGCATATCGCATAC CATGATTTTGACATGCTTGAAGAACATGTTTCCGGCACCTACCTTGTCACTATGCTTACAACTATTCTCG CGTTCATGGCCTTCAGAGTCAATACCCACGCAGTTCAAATGCCACCCGTCGCCCACGACGTTGAGAATGA TCAGCTCGTGCTTTCTGCGCACTTTGAAACAACCGATACCCCCGCTGCCCTCGAGATGGTCAAAAGATTT CACGCGGAATACACCGACTTGAAAGACTATGCGCTGACCGTCAGGCATCACCATCGACGCTGGTATGGTG TCTTCCTTCACGATGTTCAAGCTCTGCAAGACGCTCTGGTGCGGTGCCTGAATACACTGGGGGCTATGGG CATAGCGATGGACGCTGACTACATGAAGTTTGTGAACCCCGTCCTCGCCAAGACATTCGACGATACCCTC GCTAAACAGGTGATGCGACAACATCGCATGCGAATTACACGGTTCGCGAGACGGAACCCACAATACACCG ATAGACTGCGGCTCCGCCGGGTCCTGAGACTTTCACCATCCGGCCTGCCAGAGGATGTCCCATCTATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102361 representing NP_612293
Red=Cloning sites Green=Tags MDRALRDIQTDQFVPHSWMERHRLELLSAIVVSPYGPTQLQDWCVAFNTTAREALADVTVPLDASDSMVV QAVRMGAHVVDLFDMIDRRPAAFDTCVREDSIDSATFATTVGRDGYSVVHHLARRNMLATLEALKPFDWY SLSPDDHTLIDCALLGEGGRPSTVVPFFMSRGMSMNVVVPSLGITLLEQSVRTWPGEALAYLARTQYVDH MPVDVFAHMVARKNIPEAVLAWVGRFDILHDMYKDTLLMHHIAIHWQPVYSQVFDAIDIDVLNTATGPKR FYLIHCVGQGMVPVAAFKRYVPIQYWNMVDAHGNTAVATLLNLPLTDYNKNMYNIQKLTNMVDAIEHIAY HDFDMLEEHVSGTYLVTMLTTILAFMAFRVNTHAVQMPPVAHDVENDQLVLSAHFETTDTPAALEMVKRF HAEYTDLKDYALTVRHHHRRWYGVFLHDVQALQDALVRCLNTLGAMGIAMDADYMKFVNPVLAKTFDDTL AKQVMRQHRMRITRFARRNPQYTDRLRLRRVLRLSPSGLPEDVPSI TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_003494 |
ORF Size | 1608 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_003494.1, NP_612293 |
RefSeq ORF | 1608 bp |
Locus ID | 935325 |
MW | 61.0 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102291 | Myc-DDK-tagged ORF clone of viral ORF for ORF001L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612223 |
CNY 4,470.00 |
|
VC102292 | Myc-DDK-tagged ORF clone of viral ORF for ORF002R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612224 |
CNY 3,800.00 |
|
VC102293 | Myc-DDK-tagged ORF clone of viral ORF for ORF003L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612225 |
CNY 3,800.00 |
|
VC102294 | Myc-DDK-tagged ORF clone of viral ORF for ORF004L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612226 |
CNY 3,800.00 |
|
VC102295 | Myc-DDK-tagged ORF clone of viral ORF for ORF005L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612227 |
CNY 3,800.00 |
|
VC102296 | Myc-DDK-tagged ORF clone of viral ORF for putative major capsid protein [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612228 |
CNY 5,510.00 |
|
VC102297 | Myc-DDK-tagged ORF clone of viral ORF for ORF007L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612229 |
CNY 5,890.00 |
|
VC102298 | Myc-DDK-tagged ORF clone of viral ORF for ORF008R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612230 |
CNY 6,370.00 |
|
VC102299 | Myc-DDK-tagged ORF clone of viral ORF for ORF009R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612231 |
CNY 3,800.00 |
|
VC102300 | Myc-DDK-tagged ORF clone of viral ORF for ORF010L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612232 |
CNY 3,800.00 |
|
VC102301 | Myc-DDK-tagged ORF clone of viral ORF for ORF011L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612233 |
CNY 3,800.00 |
|
VC102302 | Myc-DDK-tagged ORF clone of viral ORF for putative zinc finger protein [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612234 |
CNY 3,800.00 |
|
VC102303 | Myc-DDK-tagged ORF clone of viral ORF for ORF013R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612235 |
CNY 5,610.00 |
|
VC102304 | Myc-DDK-tagged ORF clone of viral ORF for ORF014R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612236 |
CNY 3,800.00 |
|
VC102305 | Myc-DDK-tagged ORF clone of viral ORF for ORF015R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612237 |
CNY 3,800.00 |
|
VC102306 | Myc-DDK-tagged ORF clone of viral ORF for ORF016L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612238 |
CNY 3,800.00 |
|
VC102307 | Myc-DDK-tagged ORF clone of viral ORF for ORF017L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612239 |
CNY 3,800.00 |
|
VC102308 | Myc-DDK-tagged ORF clone of viral ORF for ORF018L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612240 |
CNY 3,800.00 |
|
VC102309 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA polymerase [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612241 |
CNY 14,250.00 |
|
VC102310 | Myc-DDK-tagged ORF clone of viral ORF for ORF020L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612242 |
CNY 3,800.00 |
|
VC102311 | Myc-DDK-tagged ORF clone of viral ORF for ORF021L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612243 |
CNY 3,800.00 |
|
VC102312 | Myc-DDK-tagged ORF clone of viral ORF for ORF022L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612244 |
CNY 6,080.00 |
|
VC102314 | Myc-DDK-tagged ORF clone of viral ORF for putative ribonucleotide reductase small subunit [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612246 |
CNY 3,800.00 |
|
VC102316 | Myc-DDK-tagged ORF clone of viral ORF for ORF026L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612248 |
CNY 3,800.00 |
|
VC102317 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA repair protein [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612249 |
CNY 3,800.00 |
|
VC102318 | Myc-DDK-tagged ORF clone of viral ORF for ORF028L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612250 |
CNY 17,480.00 |
|
VC102319 | Myc-DDK-tagged ORF clone of viral ORF for ORF029L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612251 |
CNY 3,800.00 |
|
VC102320 | Myc-DDK-tagged ORF clone of viral ORF for ORF030R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612252 |
CNY 3,800.00 |
|
VC102321 | Myc-DDK-tagged ORF clone of viral ORF for ORF031R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612253 |
CNY 3,800.00 |
|
VC102322 | Myc-DDK-tagged ORF clone of viral ORF for putative thymidine kinase [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612254 |
CNY 3,800.00 |
|
VC102323 | Myc-DDK-tagged ORF clone of viral ORF for ORF033L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612255 |
CNY 3,800.00 |
|
VC102324 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase II [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612256 |
CNY 15,870.00 |
|
VC102325 | Myc-DDK-tagged ORF clone of viral ORF for ORF035L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612257 |
CNY 4,560.00 |
|
VC102326 | Myc-DDK-tagged ORF clone of viral ORF for ORF036R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612258 |
CNY 4,180.00 |
|
VC102327 | Myc-DDK-tagged ORF clone of viral ORF for 0RF037L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612259 |
CNY 5,510.00 |
|
VC102328 | Myc-DDK-tagged ORF clone of viral ORF for ORFO38L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612260 |
CNY 5,800.00 |
|
VC102329 | Myc-DDK-tagged ORF clone of viral ORF for ORF039R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612261 |
CNY 3,800.00 |
|
VC102330 | Myc-DDK-tagged ORF clone of viral ORF for ORF040L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612262 |
CNY 4,470.00 |
|
VC102331 | Myc-DDK-tagged ORF clone of viral ORF for ORF041L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612263 |
CNY 5,510.00 |
|
VC102332 | Myc-DDK-tagged ORF clone of viral ORF for ORF042R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612264 |
CNY 3,800.00 |
|
VC102333 | Myc-DDK-tagged ORF clone of viral ORF for ORF043L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612265 |
CNY 3,800.00 |
|
VC102334 | Myc-DDK-tagged ORF clone of viral ORF for ORF044L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612266 |
CNY 3,800.00 |
|
VC102335 | Myc-DDK-tagged ORF clone of viral ORF for ORF045L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612267 |
CNY 3,800.00 |
|
VC102336 | Myc-DDK-tagged ORF clone of viral ORF for putative cytosine DNA methyltransferase [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612268 |
CNY 3,800.00 |
|
VC102337 | Myc-DDK-tagged ORF clone of viral ORF for ORF047R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612269 |
CNY 3,800.00 |
|
VC102338 | Myc-DDK-tagged ORF clone of viral ORF for ORF048R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612270 |
CNY 3,800.00 |
|
VC102339 | Myc-DDK-tagged ORF clone of viral ORF for ORF049R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612271 |
CNY 3,800.00 |
|
VC102340 | Myc-DDK-tagged ORF clone of viral ORF for ORF050L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612272 |
CNY 3,800.00 |
|
VC102341 | Myc-DDK-tagged ORF clone of viral ORF for ORF051R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612273 |
CNY 3,800.00 |
|
VC102342 | Myc-DDK-tagged ORF clone of viral ORF for ORF052L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612274 |
CNY 3,800.00 |
|
VC102343 | Myc-DDK-tagged ORF clone of viral ORF for ORF053R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612275 |
CNY 3,800.00 |
|
VC102344 | Myc-DDK-tagged ORF clone of viral ORF for ORF054L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612276 |
CNY 3,800.00 |
|
VC102345 | Myc-DDK-tagged ORF clone of viral ORF for ORF055L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612277 |
CNY 3,800.00 |
|
VC102346 | Myc-DDK-tagged ORF clone of viral ORF for ORF056L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612278 |
CNY 3,800.00 |
|
VC102347 | Myc-DDK-tagged ORF clone of viral ORF for ORF057L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612279 |
CNY 3,800.00 |
|
VC102348 | Myc-DDK-tagged ORF clone of viral ORF for ORF058L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612280 |
CNY 3,800.00 |
|
VC102349 | Myc-DDK-tagged ORF clone of viral ORF for ORF059R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612281 |
CNY 3,800.00 |
|
VC102350 | Myc-DDK-tagged ORF clone of viral ORF for ORF060L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612282 |
CNY 3,800.00 |
|
VC102351 | Myc-DDK-tagged ORF clone of viral ORF for ORF061L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612283 |
CNY 3,800.00 |
|
VC102352 | Myc-DDK-tagged ORF clone of viral ORF for ORF062L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612284 |
CNY 18,240.00 |
|
VC102353 | Myc-DDK-tagged ORF clone of viral ORF for putative NTPase [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612285 |
CNY 13,300.00 |
|
VC102354 | Myc-DDK-tagged ORF clone of viral ORF for putative RNA guanylytransferase [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612286 |
CNY 5,990.00 |
|
VC102355 | Myc-DDK-tagged ORF clone of viral ORF for ORF065L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612287 |
CNY 3,800.00 |
|
VC102356 | Myc-DDK-tagged ORF clone of viral ORF for ORF066L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612288 |
CNY 4,180.00 |
|
VC102357 | Myc-DDK-tagged ORF clone of viral ORF for ORF067R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612289 |
CNY 3,800.00 |
|
VC102358 | Myc-DDK-tagged ORF clone of viral ORF for ORF068L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612290 |
CNY 5,800.00 |
|
VC102359 | Myc-DDK-tagged ORF clone of viral ORF for ORF069L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612291 |
CNY 3,800.00 |
|
VC102360 | Myc-DDK-tagged ORF clone of viral ORF for ORF070L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612292 |
CNY 3,800.00 |
|
VC102362 | Myc-DDK-tagged ORF clone of viral ORF for ORF072R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612294 |
CNY 3,990.00 |
|
VC102363 | Myc-DDK-tagged ORF clone of viral ORF for ORF073R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612295 |
CNY 3,800.00 |
|
VC102364 | Myc-DDK-tagged ORF clone of viral ORF for ORF074R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612296 |
CNY 3,990.00 |
|
VC102365 | Myc-DDK-tagged ORF clone of viral ORF for ORF075L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612297 |
CNY 3,800.00 |
|
VC102366 | Myc-DDK-tagged ORF clone of viral ORF for ORF076L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612298 |
CNY 15,010.00 |
|
VC102367 | Myc-DDK-tagged ORF clone of viral ORF for putative ankyrin repeat protein [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612299 |
CNY 5,420.00 |
|
VC102368 | Myc-DDK-tagged ORF clone of viral ORF for ORF078R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612300 |
CNY 3,800.00 |
|
VC102369 | Myc-DDK-tagged ORF clone of viral ORF for ORF079L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612301 |
CNY 3,800.00 |
|
VC102370 | Myc-DDK-tagged ORF clone of viral ORF for ORF080L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612302 |
CNY 3,800.00 |
|
VC102371 | Myc-DDK-tagged ORF clone of viral ORF for ORF081R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612303 |
CNY 3,800.00 |
|
VC102372 | Myc-DDK-tagged ORF clone of viral ORF for ORF082L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612304 |
CNY 4,370.00 |
|
VC102373 | Myc-DDK-tagged ORF clone of viral ORF for ORF083L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612305 |
CNY 3,800.00 |
|
VC102374 | Myc-DDK-tagged ORF clone of viral ORF for ORF084L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612306 |
CNY 5,510.00 |
|
VC102375 | Myc-DDK-tagged ORF clone of viral ORF for ORF085R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612307 |
CNY 3,800.00 |
|
VC102376 | Myc-DDK-tagged ORF clone of viral ORF for ORF086L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612308 |
CNY 3,800.00 |
|
VC102377 | Myc-DDK-tagged ORF clone of viral ORF for putative ribonuclease [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612309 |
CNY 3,800.00 |
|
VC102378 | Myc-DDK-tagged ORF clone of viral ORF for ORF088R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612310 |
CNY 10,070.00 |
|
VC102379 | Myc-DDK-tagged ORF clone of viral ORF for ORF089R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612311 |
CNY 3,800.00 |
|
VC102380 | Myc-DDK-tagged ORF clone of viral ORF for ORF090L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612313 |
CNY 3,800.00 |
|
VC102381 | Myc-DDK-tagged ORF clone of viral ORF for ORF091L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612312 |
CNY 3,800.00 |
|
VC102382 | Myc-DDK-tagged ORF clone of viral ORF for ORF092R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612314 |
CNY 3,800.00 |
|
VC102383 | Myc-DDK-tagged ORF clone of viral ORF for ORF093L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612315 |
CNY 3,800.00 |
|
VC102384 | Myc-DDK-tagged ORF clone of viral ORF for ORF094L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612316 |
CNY 3,800.00 |
|
VC102385 | Myc-DDK-tagged ORF clone of viral ORF for ORF095L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612317 |
CNY 4,560.00 |
|
VC102386 | Myc-DDK-tagged ORF clone of viral ORF for ORF096L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612318 |
CNY 3,800.00 |
|
VC102387 | Myc-DDK-tagged ORF clone of viral ORF for ORF097R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612319 |
CNY 3,800.00 |
|
VC102388 | Myc-DDK-tagged ORF clone of viral ORF for ORF098R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612320 |
CNY 3,800.00 |
|
VC102389 | Myc-DDK-tagged ORF clone of viral ORF for ORF099L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612321 |
CNY 3,800.00 |
|
VC102390 | Myc-DDK-tagged ORF clone of viral ORF for ORF100L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612322 |
CNY 3,800.00 |
|
VC102391 | Myc-DDK-tagged ORF clone of viral ORF for ORF101L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612323 |
CNY 3,800.00 |
|
VC102392 | Myc-DDK-tagged ORF clone of viral ORF for ORF102R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612324 |
CNY 5,890.00 |
|
VC102393 | Myc-DDK-tagged ORF clone of viral ORF for ORF103R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612325 |
CNY 3,800.00 |
|
VC102394 | Myc-DDK-tagged ORF clone of viral ORF for ORF104R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612326 |
CNY 3,800.00 |
|
VC102395 | Myc-DDK-tagged ORF clone of viral ORF for ORF105R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612327 |
CNY 3,800.00 |
|
VC102396 | Myc-DDK-tagged ORF clone of viral ORF for ORF106L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612328 |
CNY 4,090.00 |
|
VC102397 | Myc-DDK-tagged ORF clone of viral ORF for ORF107L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612329 |
CNY 3,800.00 |
|
VC102398 | Myc-DDK-tagged ORF clone of viral ORF for ORF108R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612330 |
CNY 3,800.00 |
|
VC102399 | Myc-DDK-tagged ORF clone of viral ORF for ORF109L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612331 |
CNY 13,870.00 |
|
VC102400 | Myc-DDK-tagged ORF clone of viral ORF for ORF110R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612332 |
CNY 3,800.00 |
|
VC102401 | Myc-DDK-tagged ORF clone of viral ORF for putative tumor necrosis factor receptor associated factor [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612333 |
CNY 2,400.00 |
|
VC102402 | Myc-DDK-tagged ORF clone of viral ORF for ORF112R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612334 |
CNY 3,800.00 |
|
VC102403 | Myc-DDK-tagged ORF clone of viral ORF for ORF113R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612335 |
CNY 3,800.00 |
|
VC102404 | Myc-DDK-tagged ORF clone of viral ORF for ORF114L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612336 |
CNY 14,160.00 |
|
VC102405 | Myc-DDK-tagged ORF clone of viral ORF for ORF115R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612337 |
CNY 3,990.00 |
|
VC102406 | Myc-DDK-tagged ORF clone of viral ORF for ORF116L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612338 |
CNY 3,800.00 |
|
VC102408 | Myc-DDK-tagged ORF clone of viral ORF for ORF118L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612340 |
CNY 3,800.00 |
|
VC102409 | Myc-DDK-tagged ORF clone of viral ORF for ORF119L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612341 |
CNY 5,610.00 |
|
VC102410 | Myc-DDK-tagged ORF clone of viral ORF for ORF120R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612342 |
CNY 3,800.00 |
|
VC102411 | Myc-DDK-tagged ORF clone of viral ORF for ORF121R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612343 |
CNY 3,800.00 |
|
VC102412 | Myc-DDK-tagged ORF clone of viral ORF for ORF122L [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612344 |
CNY 3,800.00 |
|
VC102413 | Myc-DDK-tagged ORF clone of viral ORF for putative adenosine triphosphatase [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612345 |
CNY 3,800.00 |
|
VC102414 | Myc-DDK-tagged ORF clone of viral ORF for ORF124R [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612346 |
CNY 3,800.00 |
|
VC102415 | Myc-DDK-tagged ORF clone of viral ORF for putative ankyrin repeat protein [Infectious spleen and kidney necrosis virus], codon optimized for human cell expression, NP_612347 |
CNY 3,800.00 |
其它ORF071L产品