n-Myc (MYCN) (NM_005378) Human Mutant ORF Clone

CAT#: RC402779

  • TrueORF®

MYCN Mutant (E73X), Myc-DDK-tagged ORF clone of Homo sapiens v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) (MYCN) as transfection-ready DNA



Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

Specifications

Product Data
Product Name n-Myc (MYCN) (NM_005378) Human Mutant ORF Clone
Mutation Description E73X
Affected Codon# 73
Affected NT# 217
Nucleotide Mutation MYCN Mutant (E73X), Myc-DDK-tagged ORF clone of Homo sapiens v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian) (MYCN) as transfection-ready DNA
Effect Feingold syndrome
Synonyms bHLHe37; MODED; N-myc; NMYC; ODED
Vector pCMV6-Entry
Tag Myc-DDK
ACCN NM_005378
ORF Size 216 bp
Sequence Data
>RC402779 representing NM_005378
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGAGCTGCTCCACGTCCACCATGCCGGGCATGATCTGCAAGAACCCAGACCTCGAGTTTGACTCGC
TACAGCCCTGCTTCTACCCGGACGAAGATGACTTCTACTTCGGCGGCCCCGACTCGACCCCCCCGGGGGA
GGACATCTGGAAGAAGTTTGAGCTGCTGCCCACGCCCCCGCTGTCGCCCAGCCGTGGCTTCGCGGAGCAC
AGCTCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC402779 representing NM_005378
Red=Cloning site Green=Tags(s)

MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEH
SS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene     
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NP_005369
RefSeq Size 216 bp
RefSeq ORF 1395 bp
Locus ID 4613
Domains HLH, Myc_N_term
Protein Families Druggable Genome, Transcription Factors
MW 7.9 kDa
Gene Summary This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...