ZAK (MAP3K20) (NM_133646) Human Mass Spec Standard
CAT#: PH300069
ZAK MS Standard C13 and N15-labeled recombinant protein (NP_598407)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ZAK MS Standard C13 and N15-labeled recombinant protein (NP_598407) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200069 |
Predicted MW | 51.6 kDa |
Protein Sequence |
>RC200069 protein sequence
Red=Cloning site Green=Tags(s) MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYG VILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVV IAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLE GLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLLPLAARMSEESYFESKTEE SNSAEMSCQITATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGMQINMQAKQNSSKTTSKRRGK KVNMALGFSDFDLSEGDDDDDDDGEEEDNDMDNSE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_598407 |
RefSeq Size | 7194 |
RefSeq ORF | 1365 |
Synonyms | AZK; CNM6; MLK7; mlklak; MLT; MLTK; MLTKalpha; MLTKbeta; MRK; pk; SFMMP; ZAK |
Locus ID | 51776 |
Cytogenetics | 2q31.1 |
Summary | This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | MAPK signaling pathway, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408752 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413852 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429511 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY408752 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 2 |
CNY 3,080.00 |
|
LY413852 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1 |
CNY 4,840.00 |
|
LY429511 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1 |
CNY 4,840.00 |
|
PH321970 | ZAK MS Standard C13 and N15-labeled recombinant protein (NP_057737) |
CNY 19,520.00 |
|
TP300069 | Recombinant protein of human sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP321970 | Recombinant protein of human sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1, 20 µg |
CNY 2,900.00 |