United States
Germany
Japan
United Kingdom
China
ZAK (MAP3K20) (NM_133646) Human Recombinant Protein
CAT＃: TP300069
Recombinant protein of human sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 2, 20 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200069 protein sequence
Red=Cloning site Green=Tags(s) MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYG VILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVV IAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLE GLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLLPLAARMSEESYFESKTEE SNSAEMSCQITATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGMQINMQAKQNSSKTTSKRRGK KVNMALGFSDFDLSEGDDDDDDDGEEEDNDMDNSE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_598407 |
| Locus ID | 51776 |
| UniProt ID | Q9NYL2 |
| Refseq Size | 7194 |
| Cytogenetics | 2q31.1 |
| Refseq ORF | 1365 |
| Synonyms | AZK; CNM6; MLK7; mlklak; MLT; MLTK; MLTKalpha; MLTKbeta; MRK; pk; SFMMP; ZAK |
| Summary | This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | MAPK signaling pathway, Tight junction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408752 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413852 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC429511 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY408752 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 2 |
CNY 3,080.00 |
|
| LY413852 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1 |
CNY 4,840.00 |
|
| LY429511 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1 |
CNY 4,840.00 |
|
| PH300069 | ZAK MS Standard C13 and N15-labeled recombinant protein (NP_598407) |
CNY 19,520.00 |
|
| PH321970 | ZAK MS Standard C13 and N15-labeled recombinant protein (NP_057737) |
CNY 19,520.00 |
|
| TP321970 | Recombinant protein of human sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1, 20 µg |
CNY 2,900.00 |
