NANS (NM_018946) Human Mass Spec Standard
CAT#: PH300123
NANS MS Standard C13 and N15-labeled recombinant protein (NP_061819)
View other "NANS" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NANS MS Standard C13 and N15-labeled recombinant protein (NP_061819) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200123 |
Predicted MW | 40.3 kDa |
Protein Sequence |
>RC200123 protein sequence
Red=Cloning site Green=Tags(s) MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERP YTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNF PYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDI PIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELV DNHGKKIKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061819 |
RefSeq Size | 1257 |
RefSeq ORF | 1077 |
Synonyms | HEL-S-100; SAS; SEMDCG; SEMDG |
Locus ID | 54187 |
Cytogenetics | 9q22.33 |
Summary | This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. [provided by RefSeq, Jul 2008] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412808 | NANS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412808 | Transient overexpression lysate of N-acetylneuraminic acid synthase (NANS) |
CNY 3,080.00 |
|
TP300123 | Recombinant protein of human N-acetylneuraminic acid synthase (NANS), 20 µg |
CNY 2,900.00 |
|
TP720942 | Purified recombinant protein of Human N-acetylneuraminic acid synthase (NANS) |
CNY 3,140.00 |