NDUFB9 (NM_005005) Human Mass Spec Standard
CAT#: PH300223
NDUFB9 MS Standard C13 and N15-labeled recombinant protein (NP_004996)
View other "NDUFB9" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | NDUFB9 MS Standard C13 and N15-labeled recombinant protein (NP_004996) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200223 |
Predicted MW | 21.8 kDa |
Protein Sequence |
>RC200223 protein sequence
Red=Cloning site Green=Tags(s) MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEE FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQL QEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004996 |
RefSeq Size | 736 |
RefSeq ORF | 537 |
Synonyms | B22; CI-B22; LYRM3; MC1DN24; UQOR22 |
Locus ID | 4715 |
Cytogenetics | 8q24.13 |
Summary | The protein encoded by this gene is a subunit of the mitochondrial oxidative phosphorylation complex I (nicotinamide adenine dinucleotide: ubiquinone oxidoreductase). Complex I is localized to the inner mitochondrial membrane and functions to dehydrogenate nicotinamide adenine dinucleotide and to shuttle electrons to coenzyme Q. Complex I deficiency is the most common defect found in oxidative phosphorylation disorders and results in a range of conditions, including lethal neonatal disease, hypertrophic cardiomyopathy, liver disease, and adult-onset neurodegenerative disorders. Pseudogenes of this gene are found on chromosomes five, seven and eight. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417578 | NDUFB9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417578 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa (NDUFB9) |
CNY 3,080.00 |
|
TP300223 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa (NDUFB9), 20 µg |
CNY 2,900.00 |
|
TP761751 | Purified recombinant protein of Human NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa (NDUFB9), nuclear gene encoding mitochondrial protein, full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |