RER1 (NM_007033) Human Mass Spec Standard
CAT#: PH300545
RER1 MS Standard C13 and N15-labeled recombinant protein (NP_008964)
View other "RER1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RER1 MS Standard C13 and N15-labeled recombinant protein (NP_008964) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200545 |
Predicted MW | 23 kDa |
Protein Sequence |
>RC200545 protein sequence
Red=Cloning site Green=Tags(s) MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYA LGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMVCTFFDA FNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYRGKEDAGKAFAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_008964 |
RefSeq Size | 3118 |
RefSeq ORF | 462 |
Locus ID | 11079 |
Cytogenetics | 1p36.32 |
Summary | The protein encoded by this gene is a multi-pass membrane protein that is localized to the golgi apparatus. It is involved in the retention of endoplasmic reticulum (ER) membrane proteins in the ER and retrieval of ER membrane proteins from the early Golgi compartment to facilitate gamma-secretase complex assembly. [provided by RefSeq, Oct 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416252 | RER1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416252 | Transient overexpression lysate of RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) (RER1) |
CNY 3,080.00 |
|
TP300545 | Recombinant protein of human RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) (RER1), 20 µg |
CNY 2,900.00 |