RER1 (NM_007033) Human Recombinant Protein
CAT#: TP300545
Recombinant protein of human RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) (RER1), 20 µg
View other "RER1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200545 protein sequence
Red=Cloning site Green=Tags(s) MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYA LGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMVCTFFDA FNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYRGKEDAGKAFAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008964 |
Locus ID | 11079 |
UniProt ID | O15258 |
Refseq Size | 3118 |
Cytogenetics | 1p36.32 |
Refseq ORF | 462 |
Summary | The protein encoded by this gene is a multi-pass membrane protein that is localized to the golgi apparatus. It is involved in the retention of endoplasmic reticulum (ER) membrane proteins in the ER and retrieval of ER membrane proteins from the early Golgi compartment to facilitate gamma-secretase complex assembly. [provided by RefSeq, Oct 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416252 | RER1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416252 | Transient overexpression lysate of RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) (RER1) |
CNY 3,080.00 |
|
PH300545 | RER1 MS Standard C13 and N15-labeled recombinant protein (NP_008964) |
CNY 19,520.00 |