Apoptosis repressor with CARD (NOL3) (NM_003946) Human Mass Spec Standard
CAT#: PH300591
NOL3 MS Standard C13 and N15-labeled recombinant protein (NP_003937)
View other "Apoptosis repressor with CARD" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NOL3 MS Standard C13 and N15-labeled recombinant protein (NP_003937) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200591 |
Predicted MW | 22.6 kDa |
Protein Sequence |
>RC200591 protein sequence
Red=Cloning site Green=Tags(s) MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGE AACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPE GSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003937 |
RefSeq Size | 1540 |
RefSeq ORF | 624 |
Synonyms | ARC; FCM; MYOCL1; MYP; NOP; NOP30 |
Locus ID | 8996 |
Cytogenetics | 16q22.1 |
Summary | This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401296 | NOL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401296 | Transient overexpression lysate of nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3) |
CNY 3,080.00 |
|
TP300591 | Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), 20 µg |
CNY 2,900.00 |
|
TP720132 | Recombinant protein of human nucleolar protein 3 (apoptosis repressor with CARD domain) (NOL3), transcript variant 3. |
CNY 3,140.00 |
其它Apoptosis repressor with CARD产品