DDX19B (NM_007242) Human Mass Spec Standard
CAT#: PH300760
DDX19B MS Standard C13 and N15-labeled recombinant protein (NP_009173)
View other "DDX19B" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DDX19B MS Standard C13 and N15-labeled recombinant protein (NP_009173) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200760 |
Predicted MW | 53.9 kDa |
Protein Sequence |
>RC200760 protein sequence
Red=Cloning site Green=Tags(s) MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNL VDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQS GTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKIS EQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDS VWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLA AELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDN ETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009173 |
RefSeq Size | 1829 |
RefSeq ORF | 1437 |
Synonyms | DBP5; DDX19; RNAh |
Locus ID | 11269 |
Cytogenetics | 16q22.1 |
Summary | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416102 | DDX19B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423072 | DDX19B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423074 | DDX19B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416102 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-As) box polypeptide 19B (DDX19B), transcript variant 1 |
CNY 3,080.00 |
|
LY423072 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-As) box polypeptide 19B (DDX19B), transcript variant 3 |
CNY 3,080.00 |
|
LY423074 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-As) box polypeptide 19B (DDX19B), transcript variant 2 |
CNY 4,840.00 |
|
TP300760 | Recombinant protein of human DEAD (Asp-Glu-Ala-As) box polypeptide 19B (DDX19B), transcript variant 1, 20 µg |
CNY 2,900.00 |