TGF beta induced factor 2 (TGIF2) (NM_021809) Human Mass Spec Standard
CAT#: PH300773
TGIF2 MS Standard C13 and N15-labeled recombinant protein (NP_068581)
View other "TGF beta induced factor 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TGIF2 MS Standard C13 and N15-labeled recombinant protein (NP_068581) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200773 |
Predicted MW | 25.9 kDa |
Protein Sequence |
>RC200773 protein sequence
Red=Cloning site Green=Tags(s) MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFI NARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGE KPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAA EMELQKQQDPSLPLLHTPIPLVSENPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068581 |
RefSeq Size | 3415 |
RefSeq ORF | 711 |
Locus ID | 60436 |
Cytogenetics | 20q11.23 |
Summary | The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor, which appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and over-expressed in some ovarian cancers. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 1. Read-through transcription also exists between this gene and the neighboring downstream C20orf24 (chromosome 20 open reading frame 24) gene. [provided by RefSeq, Dec 2010] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411916 | TGIF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411916 | Transient overexpression lysate of TGFB-induced factor homeobox 2 (TGIF2) |
CNY 3,080.00 |
|
TP300773 | Recombinant protein of human TGFB-induced factor homeobox 2 (TGIF2), 20 µg |
CNY 2,900.00 |
其它TGF beta induced factor 2产品