SPSB2 (NM_032641) Human Mass Spec Standard
CAT#: PH300801
SPSB2 MS Standard C13 and N15-labeled recombinant protein (NP_116030)
View other "SPSB2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SPSB2 MS Standard C13 and N15-labeled recombinant protein (NP_116030) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200801 |
Predicted MW | 28.6 kDa |
Protein Sequence |
>RC200801 protein sequence
Red=Cloning site Green=Tags(s) MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRP VAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKL YHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQC QVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116030 |
RefSeq Size | 1272 |
RefSeq ORF | 789 |
Synonyms | GRCC9; SSB2 |
Locus ID | 84727 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes a member of a subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal suppressor of cytokine signaling (SOCS) box. This protein plays a role in cell signaling. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409988 | SPSB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431815 | SPSB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409988 | Transient overexpression lysate of splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), transcript variant 1 |
CNY 3,080.00 |
|
LY431815 | Transient overexpression lysate of splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), transcript variant 2 |
CNY 3,080.00 |
|
TP300801 | Recombinant protein of human splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2), 20 µg |
CNY 2,900.00 |