PAXX (NM_183241) Human Mass Spec Standard
CAT#: PH300944
C9orf142 MS Standard C13 and N15-labeled recombinant protein (NP_899064)
View other "PAXX" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | C9orf142 MS Standard C13 and N15-labeled recombinant protein (NP_899064) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200944 |
Predicted MW | 21.6 kDa |
Protein Sequence |
>RC200944 protein sequence
Red=Cloning site Green=Tags(s) MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAALKARFGLSAAE DITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPRLRALTLGLAKRVWSLERRLA AAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRCPGESLINPGFKSKKPAGGVDFDET SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_899064 |
RefSeq Size | 851 |
RefSeq ORF | 612 |
Synonyms | C9orf142; XLS |
Locus ID | 286257 |
Cytogenetics | 9q34.3 |
Summary | The protein encoded by this gene plays a role in the nonhomologous end joining (NHEJ) pathway of DNA double-strand break repair. The encoded protein may function to stabilize the Ku70/Ku80 heterodimer to facilitate the assembly and maintain the stability of the NHEJ complex. [provided by RefSeq, Jul 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405236 | C9orf142 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405236 | Transient overexpression lysate of chromosome 9 open reading frame 142 (C9orf142) |
CNY 3,080.00 |
|
TP300944 | Recombinant protein of human chromosome 9 open reading frame 142 (C9orf142), 20 µg |
CNY 2,900.00 |