PRC1 (NM_003981) Human Mass Spec Standard
CAT#: PH301141
PRC1 MS Standard C13 and N15-labeled recombinant protein (NP_003972)
View other "PRC1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PRC1 MS Standard C13 and N15-labeled recombinant protein (NP_003972) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201141 |
Predicted MW | 71.7 kDa |
Protein Sequence |
>RC201141 protein sequence
Red=Cloning site Green=Tags(s) MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSIS VCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHY DIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEELDHTPDTSFERDVVCEDEDAFCL SLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVD RLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKE LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNT TTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGY PGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003972 |
RefSeq Size | 3207 |
RefSeq ORF | 1860 |
Synonyms | ASE1 |
Locus ID | 9055 |
Cytogenetics | 15q26.1 |
Summary | This gene encodes a protein that is involved in cytokinesis. The protein is present at high levels during the S and G2/M phases of mitosis but its levels drop dramatically when the cell exits mitosis and enters the G1 phase. It is located in the nucleus during interphase, becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. This protein has been shown to be a substrate of several cyclin-dependent kinases (CDKs). It is necessary for polarizing parallel microtubules and concentrating the factors responsible for contractile ring assembly. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404548 | PRC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC404549 | PRC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418307 | PRC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404548 | Transient overexpression lysate of protein regulator of cytokinesis 1 (PRC1), transcript variant 2 |
CNY 4,840.00 |
|
LY404549 | Transient overexpression lysate of protein regulator of cytokinesis 1 (PRC1), transcript variant 3 |
CNY 4,840.00 |
|
LY418307 | Transient overexpression lysate of protein regulator of cytokinesis 1 (PRC1), transcript variant 1 |
CNY 3,080.00 |
|
TP301141 | Recombinant protein of human protein regulator of cytokinesis 1 (PRC1), transcript variant 1, 20 µg |
CNY 2,900.00 |