Perilipin 3 (PLIN3) (NM_005817) Human Mass Spec Standard
CAT#: PH301193
PLIN3 MS Standard C13 and N15-labeled recombinant protein (NP_005808)
View other "Perilipin 3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PLIN3 MS Standard C13 and N15-labeled recombinant protein (NP_005808) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201193 |
Predicted MW | 46.9 kDa |
Protein Sequence |
>RC201193 representing NM_005817
Red=Cloning site Green=Tags(s) MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVCDAAEKGVRTL TAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLADTKELVSSKVSGAQEMVSSAK DTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAE LARIATSLDGFDVASVQQQRQEQSYFVRLGSLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQALSLME TVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQG LPTNVKDQVQQARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP FAPGITEKAPEEKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005808 |
RefSeq Size | 2241 |
RefSeq ORF | 1302 |
Synonyms | M6PRBP1; PP17; TIP47 |
Locus ID | 10226 |
Cytogenetics | 19p13.3 |
Summary | Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417051 | PLIN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431367 | PLIN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417051 | Transient overexpression lysate of perilipin 3 (PLIN3), transcript variant 1 |
CNY 3,080.00 |
|
LY431367 | Transient overexpression lysate of perilipin 3 (PLIN3), transcript variant 3 |
CNY 3,080.00 |
|
TP301193 | Recombinant protein of human mannose-6-phosphate receptor binding protein 1 (M6PRBP1), 20 µg |
CNY 2,900.00 |
其它Perilipin 3产品