Perilipin 3 (PLIN3) (NM_005817) Human Recombinant Protein
CAT#: TP301193
Recombinant protein of human mannose-6-phosphate receptor binding protein 1 (M6PRBP1), 20 µg
View other "Perilipin 3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201193 representing NM_005817
Red=Cloning site Green=Tags(s) MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVCDAAEKGVRTL TAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLADTKELVSSKVSGAQEMVSSAK DTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAE LARIATSLDGFDVASVQQQRQEQSYFVRLGSLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQALSLME TVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQG LPTNVKDQVQQARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP FAPGITEKAPEEKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005808 |
Locus ID | 10226 |
UniProt ID | O60664 |
Refseq Size | 2241 |
Cytogenetics | 19p13.3 |
Refseq ORF | 1302 |
Synonyms | M6PRBP1; PP17; TIP47 |
Summary | Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417051 | PLIN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431367 | PLIN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417051 | Transient overexpression lysate of perilipin 3 (PLIN3), transcript variant 1 |
CNY 3,080.00 |
|
LY431367 | Transient overexpression lysate of perilipin 3 (PLIN3), transcript variant 3 |
CNY 3,080.00 |
|
PH301193 | PLIN3 MS Standard C13 and N15-labeled recombinant protein (NP_005808) |
CNY 19,520.00 |
其它Perilipin 3产品