Sigma1 receptor (SIGMAR1) (NM_005866) Human Mass Spec Standard
CAT#: PH301206
SIGMAR1 MS Standard C13 and N15-labeled recombinant protein (NP_005857)
View other "Sigma1 receptor" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SIGMAR1 MS Standard C13 and N15-labeled recombinant protein (NP_005857) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201206 |
Predicted MW | 25.1 kDa |
Protein Sequence |
>RC201206 protein sequence
Red=Cloning site Green=Tags(s) MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHP GHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGT TKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGL RLELTTYLFGQDP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005857 |
RefSeq Size | 1728 |
RefSeq ORF | 669 |
Synonyms | ALS16; DSMA2; hSigmaR1; OPRS1; SIG-1R; sigma1R; SR-BP; SR-BP1; SRBP |
Locus ID | 10280 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401778 | SIGMAR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407820 | SIGMAR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401778 | Transient overexpression lysate of sigma non-opioid intracellular receptor 1 (SIGMAR1), transcript variant 1 |
CNY 3,080.00 |
|
LY407820 | Transient overexpression lysate of sigma non-opioid intracellular receptor 1 (SIGMAR1), transcript variant 2 |
CNY 3,080.00 |
|
TP301206 | Recombinant protein of human sigma non-opioid intracellular receptor 1 (SIGMAR1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Sigma1 receptor产品