UQCRH (NM_006004) Human Mass Spec Standard
CAT#: PH301258
UQCRH MS Standard C13 and N15-labeled recombinant protein (NP_005995)
View other "UQCRH" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | UQCRH MS Standard C13 and N15-labeled recombinant protein (NP_005995) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201258 |
Predicted MW | 10.7 kDa |
Protein Sequence |
>RC201258 protein sequence
Red=Cloning site Green=Tags(s) MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEE LFDFLHARDHCVAHKLFNNLK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005995 |
RefSeq Size | 623 |
RefSeq ORF | 273 |
Synonyms | QCR6; UQCR8 |
Locus ID | 7388 |
Cytogenetics | 1p33 |
Summary | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416928 | UQCRH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416928 | Transient overexpression lysate of ubiquinol-cytochrome c reductase hinge protein (UQCRH) |
CNY 3,080.00 |
|
TP301258 | Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein (UQCRH), 20 µg |
CNY 2,900.00 |
|
TP721194 | Purified recombinant protein of Human ubiquinol-cytochrome c reductase hinge protein (UQCRH), nuclear gene encoding mitochondrial protein |
CNY 1,800.00 |