UQCRH (NM_006004) Human Recombinant Protein
CAT#: TP301258
Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein (UQCRH), 20 µg
View other "UQCRH" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201258 protein sequence
Red=Cloning site Green=Tags(s) MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEE LFDFLHARDHCVAHKLFNNLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005995 |
Locus ID | 7388 |
UniProt ID | P07919 |
Refseq Size | 623 |
Cytogenetics | 1p33 |
Refseq ORF | 273 |
Synonyms | QCR6; UQCR8 |
Summary | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416928 | UQCRH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416928 | Transient overexpression lysate of ubiquinol-cytochrome c reductase hinge protein (UQCRH) |
CNY 3,080.00 |
|
PH301258 | UQCRH MS Standard C13 and N15-labeled recombinant protein (NP_005995) |
CNY 19,520.00 |
|
TP721194 | Purified recombinant protein of Human ubiquinol-cytochrome c reductase hinge protein (UQCRH), nuclear gene encoding mitochondrial protein |
CNY 1,800.00 |