Asparagine synthetase (ASNS) (NM_001673) Human Mass Spec Standard
CAT#: PH301297
ASNS MS Standard C13 and N15-labeled recombinant protein (NP_001664)
View other "Asparagine synthetase" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_001664) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201297 |
Predicted MW | 64.4 kDa |
Protein Sequence |
>RC201297 protein sequence
Red=Cloning site Green=Tags(s) MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL WLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY GVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDV PLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK YIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE HQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK A myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001664 |
RefSeq Size | 2084 |
RefSeq ORF | 1683 |
Synonyms | ASNSD; TS11 |
Locus ID | 440 |
Cytogenetics | 7q21.3 |
Summary | The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Metabolic pathways, Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403336 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405247 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419813 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403336 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 1 |
CNY 3,080.00 |
|
LY405247 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 3 |
CNY 3,080.00 |
|
LY419813 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 2 |
CNY 3,080.00 |
|
PH301838 | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_899199) |
CNY 19,520.00 |
|
PH315380 | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_597680) |
CNY 19,520.00 |
|
TP301297 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP301838 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP315380 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Asparagine synthetase产品