PP2A-alpha (PPP2CA) (NM_002715) Human Mass Spec Standard
CAT#: PH301334
PPP2CA MS Standard C13 and N15-labeled recombinant protein (NP_002706)
View other "PP2A-alpha" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PPP2CA MS Standard C13 and N15-labeled recombinant protein (NP_002706) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201334 |
Predicted MW | 35.6 kDa |
Protein Sequence |
>RC201334 protein sequence
Red=Cloning site Green=Tags(s) MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD TLKYSFLQFDPAPRRGEPHVTRRTPDYFL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002706 |
RefSeq Size | 2643 |
RefSeq ORF | 927 |
Synonyms | NEDLBA; PP2Ac; PP2CA; PP2Calpha; RP-C |
Locus ID | 5515 |
Cytogenetics | 5q31.1 |
Summary | This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase, Transcription Factors |
Protein Pathways | Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419151 | PPP2CA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419151 | Transient overexpression lysate of protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA) |
CNY 3,080.00 |
|
TP301334 | Recombinant protein of human protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform (PPP2CA), 20 µg |
CNY 2,900.00 |
|
TP750222 | Purified recombinant protein of Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform , full length(266Ser, 269Ser), with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它PP2A-alpha产品