FZR1 (NM_016263) Human Mass Spec Standard
CAT#: PH301413
FZR1 MS Standard C13 and N15-labeled recombinant protein (NP_057347)
View other "FZR1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FZR1 MS Standard C13 and N15-labeled recombinant protein (NP_057347) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201413 |
Predicted MW | 54.8 kDa |
Protein Sequence |
>RC201413 protein sequence
Red=Cloning site Green=Tags(s) MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKS PSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPD DGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVY LWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWN AEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQ YTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLFT RIR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057347 |
RefSeq Size | 3615 |
RefSeq ORF | 1479 |
Synonyms | CDC20C; CDH1; FZR; FZR2; HCDH; HCDH1 |
Locus ID | 51343 |
Cytogenetics | 19p13.3 |
Summary | Substrate-specific adapter for the anaphase promoting complex/cyclosome (APC/C) E3 ubiquitin-protein ligase complex. Associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis. Acts as an adapter for APC/C to target the DNA-end resection factor RBBP8/CtIP for ubiquitination and subsequent proteasomal degradation. Through the regulation of RBBP8/CtIP protein turnover, may play a role in DNA damage response, favoring DNA double-strand repair through error-prone non-homologous end joining (NHEJ) over error-free, RBBP8-mediated homologous recombination (HR) (PubMed:25349192).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402526 | FZR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427845 | FZR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427846 | FZR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402526 | Transient overexpression lysate of fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 2 |
CNY 3,080.00 |
|
LY427845 | Transient overexpression lysate of fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 3 |
CNY 3,080.00 |
|
LY427846 | Transient overexpression lysate of fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 1 |
CNY 3,080.00 |
|
TP301413 | Recombinant protein of human fizzy/cell division cycle 20 related 1 (Drosophila) (FZR1), transcript variant 2, 20 µg |
CNY 2,900.00 |