SGK1 (NM_005627) Human Mass Spec Standard
CAT#: PH301535
SGK1 MS Standard C13 and N15-labeled recombinant protein (NP_005618)
View other "SGK1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SGK1 MS Standard C13 and N15-labeled recombinant protein (NP_005618) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201535 |
Predicted MW | 48.9 kDa |
Protein Sequence |
>RC201535 protein sequence
Red=Cloning site Green=Tags(s) MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMN ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEE KHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASAL GYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDW WCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIK SHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG FSYAPPTDSFL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005618 |
RefSeq Size | 2414 |
RefSeq ORF | 1293 |
Synonyms | SGK |
Locus ID | 6446 |
Cytogenetics | 6q23.2 |
Summary | This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417159 | SGK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428312 | SGK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428314 | SGK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417159 | Transient overexpression lysate of serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 1 |
CNY 3,080.00 |
|
LY428312 | Transient overexpression lysate of serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 2 |
CNY 3,080.00 |
|
LY428314 | Transient overexpression lysate of serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 4 |
CNY 3,080.00 |
|
TP301535 | Recombinant protein of human serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 1, 20 µg |
CNY 2,900.00 |