SCAMP3 (NM_005698) Human Mass Spec Standard
CAT#: PH301633
SCAMP3 MS Standard C13 and N15-labeled recombinant protein (NP_005689)
View other "SCAMP3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SCAMP3 MS Standard C13 and N15-labeled recombinant protein (NP_005689) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201633 |
Predicted MW | 38.3 kDa |
Protein Sequence |
>RC201633 protein sequence
Red=Cloning site Green=Tags(s) MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQ PSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPS FCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNNGAGFGLSILWVLLFT PCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLML LVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005689 |
RefSeq Size | 1595 |
RefSeq ORF | 1041 |
Synonyms | C1orf3 |
Locus ID | 10067 |
Cytogenetics | 1q22 |
Summary | This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401740 | SCAMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409448 | SCAMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401740 | Transient overexpression lysate of secretory carrier membrane protein 3 (SCAMP3), transcript variant 1 |
CNY 3,080.00 |
|
LY409448 | Transient overexpression lysate of secretory carrier membrane protein 3 (SCAMP3), transcript variant 2 |
CNY 3,080.00 |
|
TP301633 | Recombinant protein of human secretory carrier membrane protein 3 (SCAMP3), transcript variant 1, 20 µg |
CNY 2,900.00 |