SCAMP3 (NM_005698) Human Recombinant Protein
CAT#: TP301633
Recombinant protein of human secretory carrier membrane protein 3 (SCAMP3), transcript variant 1, 20 µg
View other "SCAMP3" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201633 protein sequence
Red=Cloning site Green=Tags(s) MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQ PSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPS FCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNNGAGFGLSILWVLLFT PCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLML LVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005689 |
Locus ID | 10067 |
UniProt ID | O14828 |
Refseq Size | 1595 |
Cytogenetics | 1q22 |
Refseq ORF | 1041 |
Synonyms | C1orf3 |
Summary | This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401740 | SCAMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409448 | SCAMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401740 | Transient overexpression lysate of secretory carrier membrane protein 3 (SCAMP3), transcript variant 1 |
CNY 3,080.00 |
|
LY409448 | Transient overexpression lysate of secretory carrier membrane protein 3 (SCAMP3), transcript variant 2 |
CNY 3,080.00 |
|
PH301633 | SCAMP3 MS Standard C13 and N15-labeled recombinant protein (NP_005689) |
CNY 19,520.00 |