RAB1A (NM_004161) Human Mass Spec Standard
CAT#: PH301640
RAB1A MS Standard C13 and N15-labeled recombinant protein (NP_004152)
View other "RAB1A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB1A MS Standard C13 and N15-labeled recombinant protein (NP_004152) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201640 |
Predicted MW | 22.7 kDa |
Protein Sequence |
>RC201640 protein sequence
Red=Cloning site Green=Tags(s) MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQ ERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAK EFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004152 |
RefSeq Size | 2648 |
RefSeq ORF | 615 |
Synonyms | RAB1; YPT1 |
Locus ID | 5861 |
Cytogenetics | 2p14 |
Summary | This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401338 | RAB1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401338 | Transient overexpression lysate of RAB1A, member RAS oncogene family (RAB1A), transcript variant 1 |
CNY 3,080.00 |
|
TP301640 | Recombinant protein of human RAB1A, member RAS oncogene family (RAB1A), transcript variant 1, 20 µg |
CNY 2,900.00 |