CD63 (NM_001780) Human Mass Spec Standard
CAT#: PH301733
CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771)
View other "CD63" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201733 |
Predicted MW | 25.6 kDa |
Protein Sequence |
>RC201733 protein sequence
Red=Cloning site Green=Tags(s) MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA LGIAFVEVLGIVFACCLVKSIRSGYEVM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001771 |
RefSeq Size | 1032 |
RefSeq ORF | 714 |
Synonyms | LAMP-3; ME491; MLA1; OMA81H; TSPAN30 |
Locus ID | 967 |
Cytogenetics | 12q13.2 |
Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419757 | CD63 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419757 | Transient overexpression lysate of CD63 molecule (CD63), transcript variant 1 |
CNY 3,080.00 |
|
TP301733 | Recombinant protein of human CD63 molecule (CD63), transcript variant 1, 20 µg |
CNY 2,900.00 |