PSMC3 (NM_002804) Human Mass Spec Standard
CAT#: PH301790
PSMC3 MS Standard C13 and N15-labeled recombinant protein (NP_002795)
View other "PSMC3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PSMC3 MS Standard C13 and N15-labeled recombinant protein (NP_002795) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201790 |
Predicted MW | 49 kDa |
Protein Sequence |
>RC201790 representing NM_002804
Red=Cloning site Green=Tags(s) MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMK DKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLV DAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKE KFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAP SIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDR KIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY MEGILEVQAKKKANLQYYA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002795 |
RefSeq Size | 1618 |
RefSeq ORF | 1317 |
Synonyms | DCIDP; RPT5; TBP1 |
Locus ID | 5702 |
Cytogenetics | 11p11.2 |
Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases that have chaperone-like activity. This subunit may compete with PSMC2 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex. A pseudogene has been identified on chromosome 9. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400992 | PSMC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400992 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 3 (PSMC3) |
CNY 3,080.00 |
|
TP301790 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, ATPase, 3 (PSMC3), 20 µg |
CNY 2,900.00 |