HNRPH1 (HNRNPH1) (NM_005520) Human Mass Spec Standard
CAT#: PH301834
HNRNPH1 MS Standard C13 and N15-labeled recombinant protein (NP_005511)
View other "HNRPH1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | HNRNPH1 MS Standard C13 and N15-labeled recombinant protein (NP_005511) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201834 |
Predicted MW | 49.2 kDa |
Protein Sequence |
>RC201834 protein sequence
Red=Cloning site Green=Tags(s) MMLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLA LKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNG ITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPY DRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG STFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKA NMQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY GGGYGGQSSMSGYDQVLQENSSDFQSNIA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005511 |
RefSeq Size | 2274 |
RefSeq ORF | 1347 |
Synonyms | hnRNPH; HNRPH; HNRPH1 |
Locus ID | 3187 |
Cytogenetics | 5q35.3 |
Summary | This gene encodes a member of a subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA. These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some may shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNA and is very similar to the family member HNRPF. This gene may be associated with hereditary lymphedema type I. Alternatively spliced transcript variants have been described [provided by RefSeq, Mar 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417247 | HNRNPH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417247 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein H1 (H) (HNRNPH1) |
CNY 3,080.00 |
|
TP301834 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein H1 (H) (HNRNPH1), 20 µg |
CNY 2,900.00 |