Endothelin 1 (EDN1) (NM_001955) Human Mass Spec Standard
CAT#: PH302217
EDN1 MS Standard C13 and N15-labeled recombinant protein (NP_001946)
View other "Endothelin 1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | EDN1 MS Standard C13 and N15-labeled recombinant protein (NP_001946) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202217 |
Predicted MW | 24.4 kDa |
Protein Sequence |
>RC202217 protein sequence
Red=Cloning site Green=Tags(s) MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRA HW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001946 |
RefSeq Size | 2112 |
RefSeq ORF | 636 |
Synonyms | ARCND3; ET1; HDLCQ7; PPET1; QME |
Locus ID | 1906 |
Cytogenetics | 6p24.1 |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Melanogenesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400720 | EDN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432690 | EDN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400720 | Transient overexpression lysate of endothelin 1 (EDN1), transcript variant 1 |
CNY 3,080.00 |
|
LY432690 | Transient overexpression lysate of endothelin 1 (EDN1), transcript variant 2 |
CNY 3,080.00 |
|
TP302217 | Recombinant protein of human endothelin 1 (EDN1), 20 µg |
CNY 2,900.00 |
其它Endothelin 1产品