Endothelin 1 (EDN1) (NM_001955) Human Recombinant Protein
CAT#: TP302217
Recombinant protein of human endothelin 1 (EDN1), 20 µg
View other "Endothelin 1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202217 protein sequence
Red=Cloning site Green=Tags(s) MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLD IIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWN NHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRA HW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001946 |
Locus ID | 1906 |
UniProt ID | P05305, Q6FH53 |
Refseq Size | 2112 |
Cytogenetics | 6p24.1 |
Refseq ORF | 636 |
Synonyms | ARCND3; ET1; HDLCQ7; PPET1; QME |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Melanogenesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400720 | EDN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432690 | EDN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400720 | Transient overexpression lysate of endothelin 1 (EDN1), transcript variant 1 |
CNY 3,080.00 |
|
LY432690 | Transient overexpression lysate of endothelin 1 (EDN1), transcript variant 2 |
CNY 3,080.00 |
|
PH302217 | EDN1 MS Standard C13 and N15-labeled recombinant protein (NP_001946) |
CNY 19,520.00 |
其它Endothelin 1产品