Prostaglandin E Synthase (PTGES) (NM_004878) Human Mass Spec Standard
CAT#: PH302405
PTGES MS Standard C13 and N15-labeled recombinant protein (NP_004869)
View other "Prostaglandin E Synthase" proteins (1)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PTGES MS Standard C13 and N15-labeled recombinant protein (NP_004869) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202405 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC202405 protein sequence
Red=Cloning site Green=Tags(s) MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLR AHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASM ALQILWEAARHL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004869 |
RefSeq Size | 1787 |
RefSeq ORF | 456 |
Synonyms | MGST-IV; MGST1-L1; MGST1L1; MPGES; mPGES-1; PGES; PIG12; PP102; PP1294; TP53I12 |
Locus ID | 9536 |
Cytogenetics | 9q34.11 |
Summary | The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP302405 | Recombinant protein of human prostaglandin E synthase (PTGES), 20 µg |
CNY 2,900.00 |
其它Prostaglandin E Synthase产品