TRAP alpha (SSR1) (NM_003144) Human Mass Spec Standard
CAT#: PH302408
SSR1 MS Standard C13 and N15-labeled recombinant protein (NP_003135)
View other "TRAP alpha" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SSR1 MS Standard C13 and N15-labeled recombinant protein (NP_003135) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202408 |
Predicted MW | 32.2 kDa |
Protein Sequence |
>RC202408 protein sequence
Red=Cloning site Green=Tags(s) MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEE EDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTAL PLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFM YMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR SVGSDE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003135 |
RefSeq Size | 9793 |
RefSeq ORF | 858 |
Synonyms | TRAPA |
Locus ID | 6745 |
Cytogenetics | 6p24.3 |
Summary | The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401093 | SSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401093 | Transient overexpression lysate of signal sequence receptor, alpha (SSR1) |
CNY 3,080.00 |
|
TP302408 | Recombinant protein of human signal sequence receptor, alpha (SSR1), 20 µg |
CNY 2,900.00 |
其它TRAP alpha产品