PKC zeta (PRKCZ) (NM_002744) Human Mass Spec Standard
CAT#: PH302472
PRKCZ MS Standard C13 and N15-labeled recombinant protein (NP_002735)
View other "PKC zeta" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PRKCZ MS Standard C13 and N15-labeled recombinant protein (NP_002735) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202472 |
Predicted MW | 67.7 kDa |
Protein Sequence |
>RC202472 protein sequence
Red=Cloning site Green=Tags(s) MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTV SSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNR RAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETD GIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAM KVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPE EHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLK GFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLT PDDEDAIKRIDQSEFEGFEYINPLLLSTEESV SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002735 |
RefSeq Size | 2359 |
RefSeq ORF | 1776 |
Synonyms | PKC-ZETA; PKC2 |
Locus ID | 5590 |
Cytogenetics | 1p36.33 |
Summary | Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Chemokine signaling pathway, Endocytosis, Insulin signaling pathway, Tight junction, Type II diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400967 | PRKCZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422406 | PRKCZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400967 | Transient overexpression lysate of protein kinase C, zeta (PRKCZ), transcript variant 1 |
CNY 3,080.00 |
|
LY422406 | Transient overexpression lysate of protein kinase C, zeta (PRKCZ), transcript variant 3 |
CNY 3,080.00 |
|
PH300438 | PRKCZ MS Standard C13 and N15-labeled recombinant protein (NP_001028753) |
CNY 19,520.00 |
|
TP300438 | Recombinant protein of human protein kinase C, zeta (PRKCZ), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP302472 | Recombinant protein of human protein kinase C, zeta (PRKCZ), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它PKC zeta产品