Triosephosphate isomerase (TPI1) (NM_000365) Human Mass Spec Standard
CAT#: PH302652
TPI1 MS Standard C13 and N15-labeled recombinant protein (NP_000356)
View other "Triosephosphate isomerase" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TPI1 MS Standard C13 and N15-labeled recombinant protein (NP_000356) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202652 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC202652 protein sequence
Red=Cloning site Green=Tags(s) MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKV TNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGIT EKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYG GSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000356 |
RefSeq Size | 1366 |
RefSeq ORF | 747 |
Synonyms | HEL-S-49; TIM; TPI; TPID |
Locus ID | 7167 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate (G3P) and dihydroxy-acetone phosphate (DHAP) in glycolysis and gluconeogenesis. Mutations in this gene are associated with triosephosphate isomerase deficiency. Pseudogenes have been identified on chromosomes 1, 4, 6 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
Protein Pathways | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Inositol phosphate metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424764 | TPI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424764 | Transient overexpression lysate of triosephosphate isomerase 1 (TPI1), transcript variant 1 |
CNY 3,080.00 |
|
TP302652 | Recombinant protein of human triosephosphate isomerase 1 (TPI1), 20 µg |
CNY 2,900.00 |
|
TP720233 | Recombinant protein of human triosephosphate isomerase 1 (TPI1) |
CNY 3,140.00 |
其它Triosephosphate isomerase产品