HAX1 (NM_006118) Human Mass Spec Standard
CAT#: PH302690
HAX1 MS Standard C13 and N15-labeled recombinant protein (NP_006109)
View other "HAX1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HAX1 MS Standard C13 and N15-labeled recombinant protein (NP_006109) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202690 |
Predicted MW | 31.6 kDa |
Protein Sequence |
>RC202690 protein sequence
Red=Cloning site Green=Tags(s) MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPG GGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRI FGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKS ISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006109 |
RefSeq Size | 1196 |
RefSeq ORF | 837 |
Synonyms | HCLSBP1; HS1BP1; SCN3 |
Locus ID | 10456 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401845 | HAX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422672 | HAX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401845 | Transient overexpression lysate of HCLS1 associated protein X-1 (HAX1), transcript variant 1 |
CNY 3,080.00 |
|
LY422672 | Transient overexpression lysate of HCLS1 associated protein X-1 (HAX1), transcript variant 2 |
CNY 3,080.00 |
|
TP302690 | Recombinant protein of human HCLS1 associated protein X-1 (HAX1), transcript variant 1, 20 µg |
CNY 2,900.00 |