SULT1C2 (NM_001056) Human Mass Spec Standard
CAT#: PH302775
SULT1C2 MS Standard C13 and N15-labeled recombinant protein (NP_001047)
View other "SULT1C2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SULT1C2 MS Standard C13 and N15-labeled recombinant protein (NP_001047) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202775 |
Predicted MW | 34.9 kDa |
Protein Sequence |
>RC202775 protein sequence
Red=Cloning site Green=Tags(s) MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEK CQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSY YHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQ FMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEI YRRKMEGTSINFCMEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001047 |
RefSeq Size | 2799 |
RefSeq ORF | 888 |
Synonyms | humSULTC2; ST1C1; ST1C2; SULT1C1 |
Locus ID | 6819 |
Cytogenetics | 2q12.3 |
Summary | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420736 | SULT1C2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420736 | Transient overexpression lysate of sulfotransferase family, cytosolic, 1C, member 2 (SULT1C2), transcript variant 1 |
CNY 3,080.00 |
|
TP302775 | Recombinant protein of human sulfotransferase family, cytosolic, 1C, member 2 (SULT1C2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720937 | Purified recombinant protein of Human sulfotransferase family, cytosolic, 1C, member 2 (SULT1C2), transcript variant 1 |
CNY 1,800.00 |
其它SULT1C2产品