PSMC6 (NM_002806) Human Mass Spec Standard
CAT#: PH302809
PSMC6 MS Standard C13 and N15-labeled recombinant protein (NP_002797)
View other "PSMC6" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PSMC6 MS Standard C13 and N15-labeled recombinant protein (NP_002797) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202809 |
Predicted MW | 44.2 kDa |
Protein Sequence |
>RC202809 protein sequence
Red=Cloning site Green=Tags(s) MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFI VKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSE QIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGE SARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATN RPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEA GMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002797 |
RefSeq Size | 1599 |
RefSeq ORF | 1167 |
Synonyms | p42; RPT5; SUG2 |
Locus ID | 5706 |
Cytogenetics | 14q22.1 |
Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, Jul 2008] |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400994 | PSMC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432217 | PSMC6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400994 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) |
CNY 3,080.00 |
|
LY432217 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6) |
CNY 3,080.00 |
|
TP302809 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), 20 µg |
CNY 2,900.00 |
|
TP761520 | Purified recombinant protein of Human proteasome (prosome, macropain) 26S subunit, ATPase, 6 (PSMC6), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |