Plunc (BPIFA1) (NM_130852) Human Mass Spec Standard
CAT#: PH303060
PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_570913)
View other "Plunc" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_570913) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203060 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC203060 protein sequence
Red=Cloning site Green=Tags(s) MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILEN LPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ VNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGI LNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_570913 |
RefSeq Size | 1090 |
RefSeq ORF | 768 |
Synonyms | bA49G10.5; LUNX; NASG; PLUNC; SPLUNC1; SPURT |
Locus ID | 51297 |
Cytogenetics | 20q11.21 |
Summary | This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known. [provided by RefSeq, Aug 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402569 | BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408781 | BPIFA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402569 | Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 1 |
CNY 3,080.00 |
|
LY408781 | Transient overexpression lysate of palate, lung and nasal epithelium associated (PLUNC), transcript variant 2 |
CNY 3,080.00 |
|
PH313322 | PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_057667) |
CNY 19,520.00 |
|
TP303060 | Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP313322 | Recombinant protein of human palate, lung and nasal epithelium associated (PLUNC), transcript variant 1, 20 µg |
CNY 2,900.00 |