SQSTM1 (NM_003900) Human Mass Spec Standard
CAT#: PH303214
SQSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_003891)
View other "SQSTM1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SQSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_003891) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203214 |
Predicted MW | 47.7 kDa |
Protein Sequence |
>RC203214 protein sequence
Red=Cloning site Green=Tags(s) MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDE DGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRY KCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRP PRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEE KSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPST GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK NYDIGAALDTIQYSKHPPPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003891 |
RefSeq Size | 2923 |
RefSeq ORF | 1320 |
Synonyms | A170; DMRV; FTDALS3; NADGP; OSIL; p60; p62; p62B; PDB3; ZIP3 |
Locus ID | 8878 |
Cytogenetics | 5q35.3 |
Summary | This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401285 | SQSTM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428020 | SQSTM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401285 | Transient overexpression lysate of sequestosome 1 (SQSTM1), transcript variant 1 |
CNY 3,080.00 |
|
LY428020 | Transient overexpression lysate of sequestosome 1 (SQSTM1), transcript variant 2 |
CNY 3,080.00 |
|
TP303214 | Recombinant protein of human sequestosome 1 (SQSTM1), transcript variant 1, 20 µg |
CNY 2,900.00 |