PMM2 (NM_000303) Human Mass Spec Standard
CAT#: PH303472
PMM2 MS Standard C13 and N15-labeled recombinant protein (NP_000294)
View other "PMM2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PMM2 MS Standard C13 and N15-labeled recombinant protein (NP_000294) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203472 |
Predicted MW | 27.9 kDa |
Protein Sequence |
>RC203472 representing NM_000303
Red=Cloning site Green=Tags(s) MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPE NGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEE RIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDK TMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000294 |
RefSeq Size | 2302 |
RefSeq ORF | 738 |
Synonyms | CDG1; CDG1a; CDGS; PMI; PMI1; PMM 2 |
Locus ID | 5373 |
Cytogenetics | 16p13.2 |
Summary | The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424809 | PMM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424809 | Transient overexpression lysate of phosphomannomutase 2 (PMM2) |
CNY 3,080.00 |
|
TP303472 | Recombinant protein of human phosphomannomutase 2 (PMM2), 20 µg |
CNY 2,900.00 |
|
TP720223 | Recombinant protein of human phosphomannomutase 2 (PMM2) |
CNY 1,800.00 |