VASP (NM_003370) Human Mass Spec Standard
CAT#: PH303544
VASP MS Standard C13 and N15-labeled recombinant protein (NP_003361)
View other "VASP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | VASP MS Standard C13 and N15-labeled recombinant protein (NP_003361) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203544 |
Predicted MW | 40.3 kDa |
Protein Sequence |
>RC203544 representing NM_003370
Red=Cloning site Green=Tags(s) MSSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRG VKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVE QQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPP LPAAQGPGGGGAGAPGLAAAIAGAKLRKVSKEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQV GEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQE LLEEVKKELQKVKEEIIEAFVQELRKRGSP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003361 |
RefSeq Size | 2298 |
RefSeq ORF | 1140 |
Locus ID | 7408 |
Cytogenetics | 19q13.32 |
Summary | Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401150 | VASP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401150 | Transient overexpression lysate of vasodilator-stimulated phosphoprotein (VASP) |
CNY 3,080.00 |
|
TP303544 | Recombinant protein of human vasodilator-stimulated phosphoprotein (VASP), 20 µg |
CNY 2,900.00 |