ACTC1 (NM_005159) Human Mass Spec Standard
CAT#: PH303655
ACTC1 MS Standard C13 and N15-labeled recombinant protein (NP_005150)
View other "ACTC1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ACTC1 MS Standard C13 and N15-labeled recombinant protein (NP_005150) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203655 |
Predicted MW | 42 kDa |
Protein Sequence |
>RC203655 protein sequence
Red=Cloning site Green=Tags(s) MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS LSTFQQMWISKQEYDEAGPSIVHRKCF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005150 |
RefSeq Size | 3693 |
RefSeq ORF | 1131 |
Synonyms | ACTC; ASD5; CMD1R; CMH11; LVNC4 |
Locus ID | 70 |
Cytogenetics | 15q14 |
Summary | Actins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC). [provided by RefSeq, Jul 2008] |
Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417479 | ACTC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417479 | Transient overexpression lysate of actin, alpha, cardiac muscle 1 (ACTC1) |
CNY 3,080.00 |
|
TP303655 | Recombinant protein of human actin, alpha, cardiac muscle 1 (ACTC1), 20 µg |
CNY 2,900.00 |