AMPK beta 1 (PRKAB1) (NM_006253) Human Mass Spec Standard
CAT#: PH303911
PRKAB1 MS Standard C13 and N15-labeled recombinant protein (NP_006244)
View other "AMPK beta 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PRKAB1 MS Standard C13 and N15-labeled recombinant protein (NP_006244) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203911 |
Predicted MW | 30.4 kDa |
Protein Sequence |
>RC203911 protein sequence
Red=Cloning site Green=Tags(s) MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN DKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEP IVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHL LQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006244 |
RefSeq Size | 2412 |
RefSeq ORF | 810 |
Synonyms | AMPK; HAMPKb |
Locus ID | 5564 |
Cytogenetics | 12q24.23 |
Summary | The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Adipocytokine signaling pathway, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416773 | PRKAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416773 | Transient overexpression lysate of protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1) |
CNY 3,080.00 |
|
TP303911 | Recombinant protein of human protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1), 20 µg |
CNY 2,900.00 |
其它AMPK beta 1产品