AMPK beta 1 (PRKAB1) (NM_006253) Human Recombinant Protein
CAT#: TP303911
Recombinant protein of human protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1), 20 µg
View other "AMPK beta 1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203911 protein sequence
Red=Cloning site Green=Tags(s) MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN DKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEP IVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHL LQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006244 |
Locus ID | 5564 |
UniProt ID | Q9Y478 |
Refseq Size | 2412 |
Cytogenetics | 12q24.23 |
Refseq ORF | 810 |
Synonyms | AMPK; HAMPKb |
Summary | The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Adipocytokine signaling pathway, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416773 | PRKAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416773 | Transient overexpression lysate of protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1) |
CNY 3,080.00 |
|
PH303911 | PRKAB1 MS Standard C13 and N15-labeled recombinant protein (NP_006244) |
CNY 19,520.00 |
其它AMPK beta 1产品