Dynein (DYNLL2) (NM_080677) Human Mass Spec Standard
CAT#: PH303913
DYNLL2 MS Standard C13 and N15-labeled recombinant protein (NP_542408)
View other "Dynein" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DYNLL2 MS Standard C13 and N15-labeled recombinant protein (NP_542408) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203913 |
Predicted MW | 10.3 kDa |
Protein Sequence |
>RC203913 protein sequence
Red=Cloning site Green=Tags(s) MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET KHFIYFYLGQVAILLFKSG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_542408 |
RefSeq Size | 1522 |
RefSeq ORF | 267 |
Synonyms | Dlc2; DNCL1B; RSPH22 |
Locus ID | 140735 |
Cytogenetics | 17q22 |
Summary | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409101 | DYNLL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409101 | Transient overexpression lysate of dynein, light chain, LC8-type 2 (DYNLL2) |
CNY 3,080.00 |
|
TP303913 | Recombinant protein of human dynein, light chain, LC8-type 2 (DYNLL2), 20 µg |
CNY 2,900.00 |