Dynein (DYNLL2) (NM_080677) Human Recombinant Protein
CAT#: TP303913M
Recombinant protein of human dynein, light chain, LC8-type 2 (DYNLL2), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203913 protein sequence
Red=Cloning site Green=Tags(s) MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET KHFIYFYLGQVAILLFKSG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_542408 |
Locus ID | 140735 |
UniProt ID | Q96FJ2 |
Refseq Size | 1522 |
Cytogenetics | 17q22 |
Refseq ORF | 267 |
Synonyms | Dlc2; DNCL1B; RSPH22 |
Summary | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |