Superoxide Dismutase 3 (SOD3) (NM_003102) Human Mass Spec Standard
CAT#: PH304156
SOD3 MS Standard C13 and N15-labeled recombinant protein (NP_003093)
View other "Superoxide Dismutase 3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SOD3 MS Standard C13 and N15-labeled recombinant protein (NP_003093) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204156 |
Predicted MW | 25.9 kDa |
Protein Sequence |
>RC204156 protein sequence
Red=Cloning site Green=Tags(s) MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSAT LDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHP QHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVV GVCGPGLWERQAREHSERKKRRRESECKAA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003093 |
RefSeq Size | 1546 |
RefSeq ORF | 720 |
Synonyms | EC-SOD |
Locus ID | 6649 |
Cytogenetics | 4p15.2 |
Summary | This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the conversion of superoxide radicals into hydrogen peroxide and oxygen, which may protect the brain, lungs, and other tissues from oxidative stress. Proteolytic processing of the encoded protein results in the formation of two distinct homotetramers that differ in their ability to interact with the extracellular matrix (ECM). Homotetramers consisting of the intact protein, or type C subunit, exhibit high affinity for heparin and are anchored to the ECM. Homotetramers consisting of a proteolytically cleaved form of the protein, or type A subunit, exhibit low affinity for heparin and do not interact with the ECM. A mutation in this gene may be associated with increased heart disease risk. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418899 | SOD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418899 | Transient overexpression lysate of superoxide dismutase 3, extracellular (SOD3) |
CNY 3,080.00 |
|
TP304156 | Recombinant protein of human superoxide dismutase 3, extracellular (SOD3), 20 µg |
CNY 2,900.00 |
其它Superoxide Dismutase 3产品