DHPS (NM_001930) Human Mass Spec Standard
CAT#: PH304235
DHPS MS Standard C13 and N15-labeled recombinant protein (NP_001921)
View other "DHPS" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | DHPS MS Standard C13 and N15-labeled recombinant protein (NP_001921) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204235 |
Predicted MW | 41 kDa |
Protein Sequence |
>RC204235 protein sequence
Red=Cloning site Green=Tags(s) MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMII LGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLL VAETFAQKMDAFMHEKNED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001921 |
RefSeq Size | 1361 |
RefSeq ORF | 1107 |
Synonyms | DHS; DS; MIG13; NEDSSWI |
Locus ID | 1725 |
Cytogenetics | 19p13.13 |
Summary | This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400714 | DHPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415606 | DHPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400714 | Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 1 |
CNY 3,080.00 |
|
LY415606 | Transient overexpression lysate of deoxyhypusine synthase (DHPS), transcript variant 3 |
CNY 3,080.00 |
|
PH322934 | DHPS MS Standard C13 and N15-labeled recombinant protein (NP_037539) |
CNY 19,520.00 |
|
TP304235 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP322934 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP720110 | Recombinant protein of human deoxyhypusine synthase (DHPS), transcript variant 1 |
CNY 4,550.00 |